DLGAP5 Antikörper (N-Term)

Produktnummer ABIN630974

Produktdetails anti-DLGAP5 Antikörper

Target: DLGAP5 (Discs, Large (Drosophila) Homolog-Associated Protein 5 (DLGAP5))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DLGAP5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DLG7 antibody was raised against the N terminal Of Dlg7

Aufreinigung: Affinity purified

Immunogen: DLG7 antibody was raised using the N terminal Of Dlg7 corresponding to a region with amino acids EYERNRHFGLKDVNIPTLEGRILVELDETSQELVPEKTNVKPRAMKTILG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DLG7 Blocking Peptide, catalog no. 33R-2820, is also available for use as a blocking control in assays to test for specificity of this DLG7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLG7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DLGAP5

Target: DLGAP5 (Discs, Large (Drosophila) Homolog-Associated Protein 5 (DLGAP5))

Andere Bezeichnung: DLG7 (DLGAP5 Produkte)

Synonyme: DLG7 antikoerper, dlg7 antikoerper, sb:cb647 antikoerper, zgc:92146 antikoerper, wu:fc96g08 antikoerper, wu:fe11c02 antikoerper, HURP antikoerper, C77459 antikoerper, C86398 antikoerper, Dap-5 antikoerper, Dlg7 antikoerper, Hurp antikoerper, mKIAA0008 antikoerper, DLG associated protein 5 antikoerper, discs, large (Drosophila) homolog-associated protein 5 antikoerper, DLGAP5 antikoerper, dlgap5 antikoerper, Dlgap5 antikoerper

Hintergrund: DLG7 is a potential cell cycle regulator that may play a role in carcinogenesis of cancer cells. It is a mitotic phosphoprotein regulated by the ubiquitin-proteasome pathway. DLG7 is the key regulator of adherens junction integrity and differentiation that may be involved in CDH1-mediated adhesion and signaling in epithelial cells.

Molekulargewicht: 95 kDa (MW of target protein)

Pathways: M Phase