DLGAP5 Antikörper (N-Term)

Produktnummer ABIN630974

Der Kaninchen Polyklonal Anti-DLGAP5-Antikörper wurde für WB validiert. Er ist geeignet, DLGAP5 in Proben von Human und Maus zu detektieren.

Kurzübersicht für DLGAP5 Antikörper (N-Term) (ABIN630974)

Target: DLGAP5 (Discs, Large (Drosophila) Homolog-Associated Protein 5 (DLGAP5))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DLGAP5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DLGAP5 Antikörper

Bindungsspezifität: N-Term

Spezifität: DLG7 antibody was raised against the N terminal Of Dlg7

Aufreinigung: Affinity purified

Immunogen: DLG7 antibody was raised using the N terminal Of Dlg7 corresponding to a region with amino acids EYERNRHFGLKDVNIPTLEGRILVELDETSQELVPEKTNVKPRAMKTILG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DLG7 Blocking Peptide, (ABIN938206), is also available for use as a blocking control in assays to test for specificity of this DLG7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLG7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DLGAP5

Target: DLGAP5 (Discs, Large (Drosophila) Homolog-Associated Protein 5 (DLGAP5))

Andere Bezeichnung: DLG7

Hintergrund: DLG7 is a potential cell cycle regulator that may play a role in carcinogenesis of cancer cells. It is a mitotic phosphoprotein regulated by the ubiquitin-proteasome pathway. DLG7 is the key regulator of adherens junction integrity and differentiation that may be involved in CDH1-mediated adhesion and signaling in epithelial cells.

Molekulargewicht: 95 kDa (MW of target protein)

Pathways: M Phase