UBE4B Antikörper

Produktnummer ABIN630903

Der Kaninchen Polyklonal anti-UBE4B Antikörper (ABIN630903) detektiert spezifisch UBE4B in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für UBE4B Antikörper (ABIN630903)

Target: UBE4B (Ubiquitin Conjugation Factor E4 B (UBE4B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBE4B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-UBE4B Antikörper

Aufreinigung: Affinity purified

Immunogen: UBE4 B antibody was raised using a synthetic peptide corresponding to a region with amino acids SPMFCSVASFGASSLSSLYESSPAPTPSFWSSVPVMGPSLASPSRAASQL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UBE4B Blocking Peptide, (ABIN5616881), is also available for use as a blocking control in assays to test for specificity of this UBE4B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBE4B

Target: UBE4B (Ubiquitin Conjugation Factor E4 B (UBE4B))

Andere Bezeichnung: UBE4B

Hintergrund: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE4B is an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly. The gene that encodes the protein is also the strongest candidate in the neuroblastoma tumor suppressor genes.

Molekulargewicht: 146 kDa (MW of target protein)