UBE4B Antikörper

Produktnummer ABIN630903

Produktdetails anti-UBE4B Antikörper

Target: UBE4B (Ubiquitin Conjugation Factor E4 B (UBE4B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBE4B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: UBE4 B antibody was raised using a synthetic peptide corresponding to a region with amino acids SPMFCSVASFGASSLSSLYESSPAPTPSFWSSVPVMGPSLASPSRAASQL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UBE4B Blocking Peptide, catalog no. 33R-8685, is also available for use as a blocking control in assays to test for specificity of this UBE4B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBE4B

Target: UBE4B (Ubiquitin Conjugation Factor E4 B (UBE4B))

Andere Bezeichnung: UBE4B (UBE4B Produkte)

Synonyme: ufd2a antikoerper, E4 antikoerper, HDNB1 antikoerper, UBOX3 antikoerper, UFD2 antikoerper, UFD2A antikoerper, 4930551I19Rik antikoerper, 4933406G05Rik antikoerper, AU014668 antikoerper, D4Bwg0973e antikoerper, UFD2a antikoerper, Ufd2p antikoerper, mKIAA0684 antikoerper, ubiquitination factor E4B antikoerper, putative ubiquitin conjugation factor E4 B antikoerper, ubiquitin conjugation factor E4 B antikoerper, ubiquitination factor E4B, UFD2 homolog (S. cerevisiae) antikoerper, Ube4b antikoerper, LINJ_30_1070 antikoerper, LBRM_30_1130 antikoerper, Tsp_12732 antikoerper, Tsp_01624 antikoerper, ube4b antikoerper, UBE4B antikoerper

Hintergrund: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE4B is an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly. The gene that encodes the protein is also the strongest candidate in the neuroblastoma tumor suppressor genes.

Molekulargewicht: 146 kDa (MW of target protein)