DCLRE1C Antikörper

Produktnummer ABIN630862

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch DCLRE1C in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für DCLRE1C Antikörper (ABIN630862)

Target: DCLRE1C (DNA Cross-Link Repair 1C (DCLRE1C))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DCLRE1C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DCLRE1C Antikörper

Aufreinigung: Affinity purified

Immunogen: DCLRE1 C antibody was raised using a synthetic peptide corresponding to a region with amino acids SSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAPTLKRRL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DCLRE1C Blocking Peptide, (ABIN5613137), is also available for use as a blocking control in assays to test for specificity of this DCLRE1C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCLRE0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DCLRE1C

Target: DCLRE1C (DNA Cross-Link Repair 1C (DCLRE1C))

Andere Bezeichnung: DCLRE1C

Hintergrund: DCLRE1C is a nuclear protein that is involved in V(D)J recombination and DNA repair. The protein has single-strand-specific 5'-3' exonuclease activity, it also exhibits endonuclease activity on 5' and 3' overhangs and hairpins when complexed with protein kinase, DNA-activated, catalytic polypeptide. Mutations in this gene cause Athabascan-type severe combined immunodeficiency (SCIDA).

Molekulargewicht: 78 kDa (MW of target protein)

Pathways: DNA Reparatur