TLR6 Antikörper (Middle Region)

Produktnummer ABIN630842

Produktdetails anti-TLR6 Antikörper

Target: TLR6 (Toll-Like Receptor 6 (TLR6))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TLR6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: TLR6 antibody was raised against the middle region of TLR6

Aufreinigung: Affinity purified

Immunogen: TLR6 antibody was raised using the middle region of TLR6 corresponding to a region with amino acids KCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYSKTTLKALTIEHIT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TLR6 Blocking Peptide, catalog no. 33R-4273, is also available for use as a blocking control in assays to test for specificity of this TLR6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TLR6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TLR6

Target: TLR6 (Toll-Like Receptor 6 (TLR6))

Andere Bezeichnung: TLR6 (TLR6 Produkte)

Synonyme: TLR1 antikoerper, TLR16 antikoerper, CD286 antikoerper, TLR-6 antikoerper, toll-like receptor 1 family member A antikoerper, toll like receptor 6 antikoerper, toll-like receptor 6 antikoerper, TLR1A antikoerper, TLR6 antikoerper, Tlr6 antikoerper

Hintergrund: TLR6 is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognise pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This receptor functionally interacts with toll-like receptor 2 to mediate cellular response to bacterial lipoproteins.

Molekulargewicht: 53 kDa (MW of target protein)

Pathways: TLR Signalweg, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Toll-Like Receptors Cascades