Fibronectin 1 Antikörper (C-Term)
-
- Target Alle Fibronectin 1 (FN1) Antikörper anzeigen
- Fibronectin 1 (FN1)
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Fibronectin 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Fibronectin 1 antibody was raised against the C terminal of FN1
- Aufreinigung
- Affinity purified
- Immunogen
- Fibronectin 1 antibody was raised using the C terminal of FN1 corresponding to a region with amino acids NCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADR
- Top Product
- Discover our top product FN1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Fibronectin 1 Blocking Peptide, catalog no. 33R-6655, is also available for use as a blocking control in assays to test for specificity of this Fibronectin 1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FN1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Fibronectin 1 (FN1)
- Andere Bezeichnung
- Fibronectin 1 (FN1 Produkte)
- Synonyme
- FN1 antikoerper, FN antikoerper, cig antikoerper, fibronectin antikoerper, finc antikoerper, lets antikoerper, msf antikoerper, Fn antikoerper, fn2 antikoerper, fb80d10 antikoerper, wu:fb80d10 antikoerper, CIG antikoerper, ED-B antikoerper, FINC antikoerper, FNZ antikoerper, GFND antikoerper, GFND2 antikoerper, LETS antikoerper, MSF antikoerper, E330027I09 antikoerper, Fn-1 antikoerper, FIBNEC antikoerper, fn-1 antikoerper, fibronectin 1 antikoerper, fibronectin 1a antikoerper, fibronectin 1 S homeolog antikoerper, FN1 antikoerper, fn1 antikoerper, fn1a antikoerper, Fn1 antikoerper, fn1.S antikoerper
- Hintergrund
- FN1 is a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. Fibronectin is involved in cell adhesion and migration processes including embryogenesis, wound healing, blood coagulation, host defense, and metastasis.
- Molekulargewicht
- 76 kDa (MW of target protein)
- Pathways
- Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis, Autophagie
-