Fibronectin 1 Antikörper (C-Term)

Produktnummer ABIN630804

Dieses Anti-Fibronectin 1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Fibronectin 1 in WB. Geeignet für Human und Hund.

Kurzübersicht für Fibronectin 1 Antikörper (C-Term) (ABIN630804)

Target: Fibronectin 1 (FN1)

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Fibronectin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Fibronectin 1 Antikörper

Bindungsspezifität: C-Term

Spezifität: Fibronectin 1 antibody was raised against the C terminal of FN1

Aufreinigung: Affinity purified

Immunogen: Fibronectin 1 antibody was raised using the C terminal of FN1 corresponding to a region with amino acids NCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADR

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Fibronectin 1 Blocking Peptide, (ABIN5613589), is also available for use as a blocking control in assays to test for specificity of this Fibronectin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Fibronectin 1

Target: Fibronectin 1 (FN1)

Andere Bezeichnung: Fibronectin 1

Hintergrund: FN1 is a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. Fibronectin is involved in cell adhesion and migration processes including embryogenesis, wound healing, blood coagulation, host defense, and metastasis.

Molekulargewicht: 76 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis, Autophagie