EPH Receptor A5 Antikörper (Middle Region)

Produktnummer ABIN630792

Produktdetails anti-EPH Receptor A5 Antikörper

Target: EPH Receptor A5 (EPHA5)

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EPH Receptor A5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Eph Receptor A5 antibody was raised against the middle region of EPHA5

Aufreinigung: Affinity purified

Immunogen: Eph Receptor A5 antibody was raised using the middle region of EPHA5 corresponding to a region with amino acids SDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Eph Receptor A5 Blocking Peptide, catalog no. 33R-8364, is also available for use as a blocking control in assays to test for specificity of this Eph Receptor A5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPHA5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EPH Receptor A5

Target: EPH Receptor A5 (EPHA5)

Andere Bezeichnung: Eph Receptor A5 (EPHA5 Produkte)

Synonyme: CEK7 antikoerper, EHK-1 antikoerper, EHK1 antikoerper, EK7 antikoerper, HEK7 antikoerper, TYRO4 antikoerper, AI854630 antikoerper, AW125296 antikoerper, Cek7 antikoerper, Ehk1 antikoerper, Els1 antikoerper, Hek7 antikoerper, Rek7 antikoerper, bsk antikoerper, Els1. antikoerper, EPHA5 antikoerper, EPH receptor A5 antikoerper, Eph receptor A5 antikoerper, EPHA5 antikoerper, epha5 antikoerper, Epha5 antikoerper

Hintergrund: EPHA5 belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Two transcript variants encoding different isoforms have been found for this gene.

Molekulargewicht: 114 kDa (MW of target protein)

Pathways: RTK Signalweg