EPH Receptor A5 Antikörper (Middle Region)

Produktnummer ABIN630792

Der Kaninchen Polyklonal anti-EPH Receptor A5 Antikörper (ABIN630792) detektiert spezifisch EPH Receptor A5 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für EPH Receptor A5 Antikörper (Middle Region) (ABIN630792)

Target: EPH Receptor A5 (EPHA5)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EPH Receptor A5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-EPH Receptor A5 Antikörper

Bindungsspezifität: Middle Region

Spezifität: Eph Receptor A5 antibody was raised against the middle region of EPHA5

Aufreinigung: Affinity purified

Immunogen: Eph Receptor A5 antibody was raised using the middle region of EPHA5 corresponding to a region with amino acids SDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Eph Receptor A5 Blocking Peptide, (ABIN5613383), is also available for use as a blocking control in assays to test for specificity of this Eph Receptor A5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPHA5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EPH Receptor A5

Target: EPH Receptor A5 (EPHA5)

Andere Bezeichnung: Eph Receptor A5

Hintergrund: EPHA5 belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Two transcript variants encoding different isoforms have been found for this gene.

Molekulargewicht: 114 kDa (MW of target protein)

Pathways: RTK Signalweg