EPH Receptor A5 Antikörper (Middle Region)
-
- Target Alle EPH Receptor A5 (EPHA5) Antikörper anzeigen
- EPH Receptor A5 (EPHA5)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EPH Receptor A5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Eph Receptor A5 antibody was raised against the middle region of EPHA5
- Aufreinigung
- Affinity purified
- Immunogen
- Eph Receptor A5 antibody was raised using the middle region of EPHA5 corresponding to a region with amino acids SDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIP
- Top Product
- Discover our top product EPHA5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Eph Receptor A5 Blocking Peptide, catalog no. 33R-8364, is also available for use as a blocking control in assays to test for specificity of this Eph Receptor A5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPHA5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EPH Receptor A5 (EPHA5)
- Andere Bezeichnung
- Eph Receptor A5 (EPHA5 Produkte)
- Hintergrund
- EPHA5 belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Two transcript variants encoding different isoforms have been found for this gene.
- Molekulargewicht
- 114 kDa (MW of target protein)
- Pathways
- RTK Signalweg
-