ABAT Antikörper (Middle Region)

Produktnummer ABIN630787

Produktdetails anti-ABAT Antikörper

Target: ABAT (4-Aminobutyrate Aminotransferase (ABAT))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ABAT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ABAT antibody was raised against the middle region of ABAT

Aufreinigung: Affinity purified

Immunogen: ABAT antibody was raised using the middle region of ABAT corresponding to a region with amino acids IIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ABAT Blocking Peptide, catalog no. 33R-4009, is also available for use as a blocking control in assays to test for specificity of this ABAT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABAT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ABAT

Target: ABAT (4-Aminobutyrate Aminotransferase (ABAT))

Andere Bezeichnung: ABAT (ABAT Produkte)

Synonyme: cb880 antikoerper, fj82a01 antikoerper, wu:fj82a01 antikoerper, BA0325 antikoerper, PSPTO0259 antikoerper, PSPTO0301 antikoerper, PSPTO1890 antikoerper, GABA-AT antikoerper, GABAT antikoerper, NPD009 antikoerper, GABA-T antikoerper, L-AIBAT antikoerper, 9630038C02Rik antikoerper, AI255750 antikoerper, ENSMUSG00000051226 antikoerper, Gabaat antikoerper, Gabat antikoerper, Gm9851 antikoerper, I54 antikoerper, Laibat antikoerper, X61497 antikoerper, beta-AlaAT antikoerper, 4-aminobutyrate aminotransferase antikoerper, 4-aminobutyrate--2-oxoglutarate transaminase antikoerper, GABA aminotransferase PLP-dependent PuuE antikoerper, 4-aminobutyrate aminotransferase, mitochondrial antikoerper, aspartate aminotransferase family protein antikoerper, 4-aminobutyrate aminotransferase S homeolog antikoerper, ABAT antikoerper, abat antikoerper, gabT antikoerper, puuE antikoerper, gabT-1 antikoerper, gabT-2 antikoerper, gabT-3 antikoerper, CNE01830 antikoerper, Mmwyl1_0047 antikoerper, CpipJ_CPIJ008729 antikoerper, KCR_RS04555 antikoerper, Bcenmc03_4909 antikoerper, Hden_0972 antikoerper, Dbac_2000 antikoerper, Mesil_2400 antikoerper, Trad_0121 antikoerper, abat.S antikoerper, Abat antikoerper

Hintergrund: 4-aminobutyrate aminotransferase (ABAT) is responsible for catabolism of gamma-aminobutyric acid (GABA), an important, mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde. The active enzyme is a homodimer of 50 kDa subunits complexed to pyridoxal-5-phosphate. ABAT in liver and brain is controlled by 2 codominant alleles with a frequency in a Caucasian population of 0.56 and 0.44. The ABAT deficiency phenotype includes psychomotor retardation, hypotonia, hyperreflexia, lethargy, refractory seizures, and EEG abnormalities.4-aminobutyrate aminotransferase (ABAT) is responsible for catabolism of gamma-aminobutyric acid (GABA), an important, mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde

Molekulargewicht: 55 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process