LIN7C Antikörper
-
- Target Alle LIN7C Antikörper anzeigen
- LIN7C (Lin-7 Homolog C (LIN7C))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LIN7C Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- LIN7 C antibody was raised using a synthetic peptide corresponding to a region with amino acids MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAV
- Top Product
- Discover our top product LIN7C Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LIN7C Blocking Peptide, catalog no. 33R-5599, is also available for use as a blocking control in assays to test for specificity of this LIN7C antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIN0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LIN7C (Lin-7 Homolog C (LIN7C))
- Andere Bezeichnung
- LIN7C (LIN7C Produkte)
- Hintergrund
- LIN7C plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. It forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains.
- Molekulargewicht
- 22 kDa (MW of target protein)
- Pathways
- Synaptic Membrane
-