LIN7C Antikörper

Produktnummer ABIN630769

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch LIN7C in WB. Es zeigt Reaktivität gegenüber Proben von Human, Ratte und Maus.

Kurzübersicht für LIN7C Antikörper (ABIN630769)

Target: LIN7C (Lin-7 Homolog C (LIN7C))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LIN7C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LIN7C Antikörper

Aufreinigung: Affinity purified

Immunogen: LIN7 C antibody was raised using a synthetic peptide corresponding to a region with amino acids MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LIN7C Blocking Peptide, (ABIN5614458), is also available for use as a blocking control in assays to test for specificity of this LIN7C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIN0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LIN7C

Target: LIN7C (Lin-7 Homolog C (LIN7C))

Andere Bezeichnung: LIN7C

Hintergrund: LIN7C plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. It forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains.

Molekulargewicht: 22 kDa (MW of target protein)

Pathways: Synaptic Membrane