MLF1 Antikörper (N-Term)
-
- Target Alle MLF1 Antikörper anzeigen
- MLF1 (Myeloid Leukemia Factor 1 (MLF1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MLF1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MLF1 antibody was raised against the N terminal of MLF1
- Aufreinigung
- Affinity purified
- Immunogen
- MLF1 antibody was raised using the N terminal of MLF1 corresponding to a region with amino acids GRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTMDQMVSNMRNYMQ
- Top Product
- Discover our top product MLF1 Primärantikörper
-
anti-Myeloid Leukemia Factor 1 (MLF1) antibody
MLF1 Reaktivität: Human WB, IHC, FACS, IF, IHC (p) Wirt: Maus Monoclonal 3A3 unconjugated
anti-Myeloid Leukemia Factor 1 (MLF1) (AA 215-244), (C-Term) antibodyMLF1 Reaktivität: Human, Maus WB, FACS, IHC (p) Wirt: Kaninchen Polyclonal RB18643 unconjugated
anti-Myeloid Leukemia Factor 1 (MLF1) (pThr78) antibodyMLF1 Reaktivität: Human WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Myeloid Leukemia Factor 1 (MLF1) antibodyMLF1 Reaktivität: Maus, Ratte WB, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Myeloid Leukemia Factor 1 (MLF1) (AA 1-268) antibodyMLF1 Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Myeloid Leukemia Factor 1 (MLF1) (AA 1-268) antibodyMLF1 Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Myeloid Leukemia Factor 1 (MLF1) (AA 35-62), (N-Term) antibodyMLF1 Reaktivität: Human, Maus WB Wirt: Kaninchen Polyclonal RB18642 unconjugated
anti-Myeloid Leukemia Factor 1 (MLF1) (AA 1-268) antibodyMLF1 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Myeloid Leukemia Factor 1 (MLF1) (AA 1-268) antibodyMLF1 Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Myeloid Leukemia Factor 1 (MLF1) (AA 91-126) antibodyMLF1 Reaktivität: Human, Maus WB Wirt: Kaninchen Polyclonal RB51172 unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MLF1 Blocking Peptide, catalog no. 33R-3521, is also available for use as a blocking control in assays to test for specificity of this MLF1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLF1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MLF1 (Myeloid Leukemia Factor 1 (MLF1))
- Andere Bezeichnung
- MLF1 (MLF1 Produkte)
- Synonyme
- MLF1 antikoerper, HLS7 antikoerper, myeloid leukemia factor 1 antikoerper, myeloid leukemia factor 1 L homeolog antikoerper, MLF1 antikoerper, mlf1.L antikoerper, mlf1 antikoerper, Mlf1 antikoerper
- Hintergrund
- MLF1 is involved in lineage commitment of primary hemopoietic progenitors by restricting erythroid formation and enhancing myeloid formation. It interferes with erythopoietin-induced erythroid terminal differentiation by preventing cells from exiting the cell cycle through suppression of CDKN1B/p27Kip1 levels. MLF1 suppresses RFWD2/COP1 activity via CSN3 which activates p53 and induces cell cycle arrest.It binds DNA and affects the expression of a number of genes so may function as a transcription factor in the nucleus.
- Molekulargewicht
- 29 kDa (MW of target protein)
-
