MLF1 Antikörper (N-Term)

Produktnummer ABIN630719

Der Kaninchen Polyklonal Anti-MLF1-Antikörper wurde für WB validiert. Er ist geeignet, MLF1 in Proben von Human zu detektieren.

Kurzübersicht für MLF1 Antikörper (N-Term) (ABIN630719)

Target: MLF1 (Myeloid Leukemia Factor 1 (MLF1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MLF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MLF1 Antikörper

Bindungsspezifität: N-Term

Spezifität: MLF1 antibody was raised against the N terminal of MLF1

Aufreinigung: Affinity purified

Immunogen: MLF1 antibody was raised using the N terminal of MLF1 corresponding to a region with amino acids GRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTMDQMVSNMRNYMQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MLF1 Blocking Peptide, (ABIN938907), is also available for use as a blocking control in assays to test for specificity of this MLF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MLF1

Target: MLF1 (Myeloid Leukemia Factor 1 (MLF1))

Andere Bezeichnung: MLF1

Hintergrund: MLF1 is involved in lineage commitment of primary hemopoietic progenitors by restricting erythroid formation and enhancing myeloid formation. It interferes with erythopoietin-induced erythroid terminal differentiation by preventing cells from exiting the cell cycle through suppression of CDKN1B/p27Kip1 levels. MLF1 suppresses RFWD2/COP1 activity via CSN3 which activates p53 and induces cell cycle arrest.It binds DNA and affects the expression of a number of genes so may function as a transcription factor in the nucleus.

Molekulargewicht: 29 kDa (MW of target protein)