PARP3 Antikörper
-
- Target Alle PARP3 Antikörper anzeigen
- PARP3 (Poly (ADP-Ribose) Polymerase Family, Member 3 (PARP3))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PARP3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Affinity purified
- Immunogen
- PARP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVP
- Top Product
- Discover our top product PARP3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1-2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PARP3 Blocking Peptide, catalog no. 33R-4994, is also available for use as a blocking control in assays to test for specificity of this PARP3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PARP3 (Poly (ADP-Ribose) Polymerase Family, Member 3 (PARP3))
- Andere Bezeichnung
- PARP3 (PARP3 Produkte)
- Synonyme
- ADPRT-3 antikoerper, PARP-3 antikoerper, PM38 antikoerper, Adprtl3 antikoerper, fj17c06 antikoerper, wu:fj17c06 antikoerper, zgc:66157 antikoerper, PARP3 antikoerper, parp3 antikoerper, ADPRT3 antikoerper, ADPRTL2 antikoerper, ADPRTL3 antikoerper, ARTD3 antikoerper, IRT1 antikoerper, PADPRT-3 antikoerper, A930002C11Rik antikoerper, AW990611 antikoerper, Adprt3 antikoerper, pADPRT-3 antikoerper, seed maturation protein PM38 antikoerper, poly (ADP-ribose) polymerase family, member 3 antikoerper, poly(ADP-ribose) polymerase family member 3 antikoerper, poly(ADP-ribose) polymerase family member 3 L homeolog antikoerper, PARP3 antikoerper, parp3 antikoerper, parp3.L antikoerper, Parp3 antikoerper
- Hintergrund
- PARP3 belongs to the PARP family. These enzymes modify nuclear proteins by poly-ADP-ribosylation, which is required for DNA repair, regulation of apoptosis, and maintenance of genomic stability. PARP3 is preferentially localized to the daughter centriole throughout the cell cycle. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Molekulargewicht
- 59 kDa (MW of target protein)
-