SETDB2 Antikörper (N-Term)

Produktnummer ABIN630677

Produktdetails anti-SETDB2 Antikörper

Target: SETDB2 (SET Domain, Bifurcated 2 (SETDB2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SETDB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SETDB2 antibody was raised against the N terminal of SETDB2

Aufreinigung: Affinity purified

Immunogen: SETDB2 antibody was raised using the N terminal of SETDB2 corresponding to a region with amino acids ASQKEVNAQSSDPMPVTQKEQENKSNAFPSTSCENSFPEDCTFLTTGNKE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SETDB2 Blocking Peptide, catalog no. 33R-1523, is also available for use as a blocking control in assays to test for specificity of this SETDB2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SETDB2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SETDB2

Target: SETDB2 (SET Domain, Bifurcated 2 (SETDB2))

Andere Bezeichnung: SETDB2 (SETDB2 Produkte)

Synonyme: C13orf4 antikoerper, CLLD8 antikoerper, CLLL8 antikoerper, KMT1F antikoerper, Clld8 antikoerper, Gm293 antikoerper, SET domain bifurcated 2 antikoerper, SET domain, bifurcated 2 antikoerper, SETDB2 antikoerper, Setdb2 antikoerper

Hintergrund: Proteins that contain a SET domain, such as SETDB2, modulate gene expression epigenetically through histone H3 methylation. SETDB2 is likely a histone H3 methyltransferase, as it contains both the active site and flanking cysteine residues required for catalytic activity.

Molekulargewicht: 77 kDa (MW of target protein)