SETDB2 Antikörper (N-Term)
-
- Target Alle SETDB2 Antikörper anzeigen
- SETDB2 (SET Domain, Bifurcated 2 (SETDB2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SETDB2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SETDB2 antibody was raised against the N terminal of SETDB2
- Aufreinigung
- Affinity purified
- Immunogen
- SETDB2 antibody was raised using the N terminal of SETDB2 corresponding to a region with amino acids ASQKEVNAQSSDPMPVTQKEQENKSNAFPSTSCENSFPEDCTFLTTGNKE
- Top Product
- Discover our top product SETDB2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SETDB2 Blocking Peptide, catalog no. 33R-1523, is also available for use as a blocking control in assays to test for specificity of this SETDB2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SETDB2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SETDB2 (SET Domain, Bifurcated 2 (SETDB2))
- Andere Bezeichnung
- SETDB2 (SETDB2 Produkte)
- Synonyme
- C13orf4 antikoerper, CLLD8 antikoerper, CLLL8 antikoerper, KMT1F antikoerper, Clld8 antikoerper, Gm293 antikoerper, SET domain bifurcated 2 antikoerper, SET domain, bifurcated 2 antikoerper, SETDB2 antikoerper, Setdb2 antikoerper
- Hintergrund
- Proteins that contain a SET domain, such as SETDB2, modulate gene expression epigenetically through histone H3 methylation. SETDB2 is likely a histone H3 methyltransferase, as it contains both the active site and flanking cysteine residues required for catalytic activity.
- Molekulargewicht
- 77 kDa (MW of target protein)
-