ESRRA Antikörper (N-Term)

Produktnummer ABIN630497

Produktdetails anti-ESRRA Antikörper

Target: ESRRA (Estrogen-Related Receptor alpha (ESRRA))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ESRRA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ESRRA antibody was raised against the N terminal of ESRRA

Aufreinigung: Affinity purified

Immunogen: ESRRA antibody was raised using the N terminal of ESRRA corresponding to a region with amino acids KEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ESRRA Blocking Peptide, catalog no. 33R-4336, is also available for use as a blocking control in assays to test for specificity of this ESRRA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ESRRA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ESRRA

Target: ESRRA (Estrogen-Related Receptor alpha (ESRRA))

Andere Bezeichnung: ESRRA (ESRRA Produkte)

Synonyme: err1 antikoerper, erra antikoerper, esrral antikoerper, erralpha antikoerper, nr3b1 antikoerper, MGC80854 antikoerper, ESRRA antikoerper, esrl1 antikoerper, LOC100125507 antikoerper, ERRalpha antikoerper, Err1 antikoerper, Estrra antikoerper, Nr3b1 antikoerper, Errra antikoerper, ERR1 antikoerper, ERRa antikoerper, ESRL1 antikoerper, NR3B1 antikoerper, ESTRRA antikoerper, estrogen-related receptor alpha antikoerper, estrogen related receptor alpha L homeolog antikoerper, estrogen related receptor alpha antikoerper, catsper channel auxiliary subunit zeta antikoerper, estrogen related receptor, alpha antikoerper, esrra antikoerper, esrra.L antikoerper, ESRRA antikoerper, LOC100125507 antikoerper, CATSPERZ antikoerper, Esrra antikoerper

Hintergrund: ESRRA is a nuclear receptor that is closely related to the estrogen receptor. This protein acts as a site-specific transcription regulator and has been also shown to interact with estrogen and the transcripton factor TFIIB by direct protein-protein contact. The binding and regulatory activities of this protein have been demonstrated in the regulation of a variety of genes including lactoferrin, osteopontin, medium-chain acyl coenzyme A dehydrogenase (MCAD) and thyroid hormone receptor genes.

Molekulargewicht: 46 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Lipid Metabolism by PPARalpha