ESRRA Antikörper (N-Term)

Produktnummer ABIN630497

Der Kaninchen Polyklonal Anti-ESRRA-Antikörper wurde für WB validiert. Er ist geeignet, ESRRA in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für ESRRA Antikörper (N-Term) (ABIN630497)

Target: ESRRA (Estrogen-Related Receptor alpha (ESRRA))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ESRRA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ESRRA Antikörper

Bindungsspezifität: N-Term

Spezifität: ESRRA antibody was raised against the N terminal of ESRRA

Aufreinigung: Affinity purified

Immunogen: ESRRA antibody was raised using the N terminal of ESRRA corresponding to a region with amino acids KEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ESRRA Blocking Peptide, (ABIN939722), is also available for use as a blocking control in assays to test for specificity of this ESRRA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ESRRA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ESRRA

Target: ESRRA (Estrogen-Related Receptor alpha (ESRRA))

Andere Bezeichnung: ESRRA

Hintergrund: ESRRA is a nuclear receptor that is closely related to the estrogen receptor. This protein acts as a site-specific transcription regulator and has been also shown to interact with estrogen and the transcripton factor TFIIB by direct protein-protein contact. The binding and regulatory activities of this protein have been demonstrated in the regulation of a variety of genes including lactoferrin, osteopontin, medium-chain acyl coenzyme A dehydrogenase (MCAD) and thyroid hormone receptor genes.

Molekulargewicht: 46 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Lipid Metabolism by PPARalpha