Butyrylcholinesterase Antikörper (N-Term)

Produktnummer ABIN630462

Dieses Anti-Butyrylcholinesterase-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Butyrylcholinesterase in WB und IHC. Geeignet für Human, Hund und Maus.

Kurzübersicht für Butyrylcholinesterase Antikörper (N-Term) (ABIN630462)

Target: Butyrylcholinesterase (BCHE)

Reaktivität: Human, Hund, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Butyrylcholinesterase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-Butyrylcholinesterase Antikörper

Bindungsspezifität: N-Term

Spezifität: BCHE antibody was raised against the N terminal of BCHE

Aufreinigung: Purified

Immunogen: BCHE antibody was raised using the N terminal of BCHE corresponding to a region with amino acids SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BCHE Blocking Peptide, (ABIN5612293), is also available for use as a blocking control in assays to test for specificity of this BCHE antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCHE antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Butyrylcholinesterase

Target: Butyrylcholinesterase (BCHE)

Andere Bezeichnung: BCHE

Hintergrund: Mutant alleles at the BCHE locus are responsible for suxamethonium sensitivity. Homozygous persons sustain prolonged apnea after administration of the muscle relaxant suxamethonium in connection with surgical anesthesia. The activity of pseudocholinesterase in the serum is low and its substrate behavior is atypical. In the absence of the relaxant, the homozygote is at no known disadvantage.

Molekulargewicht: 68 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism