FADS1 Antikörper (C-Term)

Produktnummer ABIN630410

Der Kaninchen Polyklonal Anti-FADS1-Antikörper wurde für WB und IHC validiert. Er ist geeignet, FADS1 in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für FADS1 Antikörper (C-Term) (ABIN630410)

Target: FADS1 (Fatty Acid Desaturase 1 (FADS1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FADS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-FADS1 Antikörper

Bindungsspezifität: C-Term

Spezifität: FADS1 antibody was raised against the C terminal of FADS1

Aufreinigung: Purified

Immunogen: FADS1 antibody was raised using the C terminal of FADS1 corresponding to a region with amino acids FNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FADS1 Blocking Peptide, (ABIN938388), is also available for use as a blocking control in assays to test for specificity of this FADS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FADS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FADS1

Target: FADS1 (Fatty Acid Desaturase 1 (FADS1))

Andere Bezeichnung: FADS1

Hintergrund: FADS1 is a member of the fatty acid desaturase (FADS) family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs.

Molekulargewicht: 49 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha