UBE2D2 Antikörper

Produktnummer ABIN630401

Der Kaninchen Polyklonal Anti-UBE2D2-Antikörper wurde für WB und IHC validiert. Er ist geeignet, UBE2D2 in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für UBE2D2 Antikörper (ABIN630401)

Target: UBE2D2 (Ubiquitin-Conjugating Enzyme E2D 2 (UBE2D2))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBE2D2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-UBE2D2 Antikörper

Aufreinigung: Purified

Immunogen: UBE2 D2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIARE

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UBE2D2 Blocking Peptide, (ABIN5616861), is also available for use as a blocking control in assays to test for specificity of this UBE2D2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBE2D2

Target: UBE2D2 (Ubiquitin-Conjugating Enzyme E2D 2 (UBE2D2))

Andere Bezeichnung: UBE2D2

Hintergrund: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2D2 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase.SLC38A4 is found predominantly in liver and transports both cationic and neutral amino acids. The transport of cationic amino acids by SLC38A4 is Na(+) and pH independent, while the transport of neutral amino acids is Na(+) and pH dependent.

Molekulargewicht: 60 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Toll-Like Receptors Cascades