GJB1 Antikörper (C-Term)

Produktnummer ABIN630257

Produktdetails anti-GJB1 Antikörper

Target: GJB1 (Gap Junction Protein, beta 1, 32kDa (GJB1))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GJB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: GJB1 antibody was raised against the C terminal of GJB1

Aufreinigung: Purified

Immunogen: GJB1 antibody was raised using the C terminal of GJB1 corresponding to a region with amino acids GFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GJB1 Blocking Peptide, catalog no. 33R-3256, is also available for use as a blocking control in assays to test for specificity of this GJB1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GJB1

Target: GJB1 (Gap Junction Protein, beta 1, 32kDa (GJB1))

Andere Bezeichnung: GJB1 (GJB1 Produkte)

Synonyme: GJIC antikoerper, cmtx antikoerper, cmtx1 antikoerper, connexin-30 antikoerper, connexin32 antikoerper, cx30 antikoerper, cx32 antikoerper, gja1 antikoerper, CX32 antikoerper, GJB1 antikoerper, AI118175 antikoerper, Cnx32 antikoerper, Cx32 antikoerper, Gjb-1 antikoerper, CMTX antikoerper, CMTX1 antikoerper, gjb1-a antikoerper, gap junction protein beta 1 antikoerper, connexin 32 antikoerper, probable serine/threonine-protein kinase CST antikoerper, gap junction protein, beta 1 antikoerper, gap junction protein beta 1 L homeolog antikoerper, gjb1 antikoerper, CX32 antikoerper, LOC9303136 antikoerper, GJB1 antikoerper, Gjb1 antikoerper, gjb1.L antikoerper

Hintergrund: This gene encodes for a Connexin 32 protein. A large Charcot-Marie-Tooth disease family has been identified with a novel mutation in the Cx32 P2 promoter region at position -526bp. Cx32 mutants that are associated with a CNS phenotype may have toxic effects in oligodendrocytes.

Molekulargewicht: 31 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization