Annexin V Antikörper (N-Term)

Produktnummer ABIN630242

Der Kaninchen Polyklonal Anti-Annexin V-Antikörper wurde für WB validiert. Er ist geeignet, Annexin V in Proben von Chemical zu detektieren.

Kurzübersicht für Annexin V Antikörper (N-Term) (ABIN630242)

Target: Annexin V (ANXA5) (Annexin A5 (ANXA5))

Reaktivität: Chemical

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Annexin V Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Annexin V Antikörper

Bindungsspezifität: N-Term

Spezifität: Annexin A5 antibody was raised against the N terminal of ANXA5

Kreuzreaktivität: Human, Hund

Aufreinigung: Purified

Immunogen: Annexin A5 antibody was raised using the N terminal of ANXA5 corresponding to a region with amino acids AYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVV

Anwendungsinformationen

Applikationshinweise: WB: 0.625 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Annexin A5 Blocking Peptide, (ABIN937012), is also available for use as a blocking control in assays to test for specificity of this Annexin A5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Annexin V

Target: Annexin V (ANXA5) (Annexin A5 (ANXA5))

Andere Bezeichnung: Annexin A5

Substanzklasse: Chemical

Hintergrund: The protein encoded by ANXA5 belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII.

Molekulargewicht: 35 kDa (MW of target protein)

Pathways: Apoptose