Annexin V Antikörper (N-Term)
-
- Target Alle Annexin V (ANXA5) Antikörper anzeigen
- Annexin V (ANXA5) (Annexin A5 (ANXA5))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Chemical
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Annexin V Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Annexin A5 antibody was raised against the N terminal of ANXA5
- Kreuzreaktivität
- Human, Maus, Ratte (Rattus), Hund
- Aufreinigung
- Purified
- Immunogen
- Annexin A5 antibody was raised using the N terminal of ANXA5 corresponding to a region with amino acids SELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPE
- Top Product
- Discover our top product ANXA5 Primärantikörper
-
anti-Annexin A5 (ANXA5) (AA 1-320) antibody
ANXA5 Reaktivität: Human WB, ELISA, IP, IHC (p), IF Wirt: Maus Monoclonal 1F4-1A5 unconjugated
anti-Annexin A5 (ANXA5) (AA 1-320) antibodyANXA5 Reaktivität: Human WB, IHC, IP, ICC Wirt: Maus Monoclonal C7 unconjugated
anti-Annexin A5 (ANXA5) (AA 1-321) antibodyANXA5 Reaktivität: Rind (Kuh) WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Annexin A5 (ANXA5) (AA 160-320) antibodyANXA5 Reaktivität: Human WB, ELISA, ICC, FACS Wirt: Maus Monoclonal 3B9B7 unconjugated
anti-Annexin A5 (ANXA5) (AA 1-320) antibodyANXA5 Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Annexin A5 (ANXA5) (AA 160-320) antibodyANXA5 Reaktivität: Human WB, ELISA, FACS Wirt: Maus Monoclonal 3B9F3 unconjugated
anti-Annexin A5 (ANXA5) (AA 88-102), (Middle Region) antibodyANXA5 Reaktivität: Human, Ratte WB, ICC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Annexin A5 (ANXA5) (AA 2-320) antibodyANXA5 Reaktivität: Human, Maus, Ratte WB, IHC (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Annexin A5 (ANXA5) (AA 88-102) antibodyANXA5 Reaktivität: Human, Maus, Ratte WB, ICC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Annexin A5 (ANXA5) (AA 2-320) antibodyANXA5 Reaktivität: Human WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Annexin A5 Blocking Peptide, catalog no. 33R-8393, is also available for use as a blocking control in assays to test for specificity of this Annexin A5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Annexin V (ANXA5) (Annexin A5 (ANXA5))
- Andere Bezeichnung
- Annexin A5 (ANXA5 Produkte)
- Substanzklasse
- Chemical
- Hintergrund
- The protein encoded by ANXA5 belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII.
- Molekulargewicht
- 35 kDa (MW of target protein)
- Pathways
- Apoptose
-
