MSH2 Antikörper
-
- Target Alle MSH2 Antikörper anzeigen
- MSH2 (Mismatch Repair Protein 2 (MSH2))
-
Reaktivität
- Human, Ratte, Hund, Zebrafisch (Danio rerio)
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MSH2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- MSH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KMSAVDGQRQVGVGYVDSIQRKLGLCEFPDNDQFSNLEALLIQIGPKECV
- Top Product
- Discover our top product MSH2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MSH2 Blocking Peptide, catalog no. 33R-4562, is also available for use as a blocking control in assays to test for specificity of this MSH2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSH2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MSH2 (Mismatch Repair Protein 2 (MSH2))
- Andere Bezeichnung
- MSH2 (MSH2 Produkte)
- Synonyme
- COCA1 antikoerper, FCC1 antikoerper, HNPCC antikoerper, HNPCC1 antikoerper, LCFS2 antikoerper, AI788990 antikoerper, wu:fc06b02 antikoerper, wu:fc13e09 antikoerper, zgc:55333 antikoerper, ATMSH2 antikoerper, MUTS homolog 2 antikoerper, msh2 antikoerper, mutS homolog 2 antikoerper, mutS homolog 2 (E. coli) antikoerper, MUTS homolog 2 antikoerper, mutS homolog 2 L homeolog antikoerper, MutS protein homolog 2 antikoerper, MSH2 antikoerper, Msh2 antikoerper, msh2 antikoerper, msh2.L antikoerper
- Hintergrund
- MSH2 was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC.
- Molekulargewicht
- 64 kDa (MW of target protein)
- Pathways
- DNA Reparatur, Production of Molecular Mediator of Immune Response
-