MSH2 Antikörper

Produktnummer ABIN630207

Der Kaninchen Polyklonal anti-MSH2 Antikörper (ABIN630207) detektiert spezifisch MSH2 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Ratte, Hund und Zebrafisch (Danio rerio).

Kurzübersicht für MSH2 Antikörper (ABIN630207)

Target: MSH2 (Mismatch Repair Protein 2 (MSH2))

Reaktivität: Human, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MSH2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MSH2 Antikörper

Aufreinigung: Purified

Immunogen: MSH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KMSAVDGQRQVGVGYVDSIQRKLGLCEFPDNDQFSNLEALLIQIGPKECV

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MSH2 Blocking Peptide, (ABIN939948), is also available for use as a blocking control in assays to test for specificity of this MSH2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSH2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MSH2

Target: MSH2 (Mismatch Repair Protein 2 (MSH2))

Andere Bezeichnung: MSH2

Hintergrund: MSH2 was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC.

Molekulargewicht: 64 kDa (MW of target protein)

Pathways: DNA Reparatur, Production of Molecular Mediator of Immune Response