LIG4 Antikörper (N-Term)

Produktnummer ABIN630196

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch LIG4 in WB und IHC. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für LIG4 Antikörper (N-Term) (ABIN630196)

Target: LIG4 (Ligase IV, DNA, ATP-Dependent (LIG4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LIG4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-LIG4 Antikörper

Bindungsspezifität: N-Term

Spezifität: LIG4 antibody was raised against the N terminal of LIG4

Aufreinigung: Purified

Immunogen: LIG4 antibody was raised using the N terminal of LIG4 corresponding to a region with amino acids DGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQ

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LIG4 Blocking Peptide, (ABIN937334), is also available for use as a blocking control in assays to test for specificity of this LIG4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIG4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LIG4

Target: LIG4 (Ligase IV, DNA, ATP-Dependent (LIG4))

Andere Bezeichnung: LIG4

Hintergrund: LIG4 encodes a DNA ligase that joins single-strand breaks in a double-stranded polydeoxynucleotide in an ATP-dependent reaction. This protein is essential for V(D)J recombination and DNA double-strand break (DSB) repair through nonhomologous end joining (NHEJ). This protein forms a complex with the X-ray repair cross complementing protein 4 (XRCC4), and further interacts with the DNA-dependent protein kinase (DNA-PK). Both XRCC4 and DNA-PK are known to be required for NHEJ. The crystal structure of the complex formed by this protein and XRCC4 has been resolved. Defects in this gene are the cause of LIG4 syndrome.

Molekulargewicht: 104 kDa (MW of target protein)

Pathways: DNA Reparatur, Production of Molecular Mediator of Immune Response