MCM7 Antikörper (Middle Region)
-
- Target Alle MCM7 Antikörper anzeigen
- MCM7 (Minichromosome Maintenance Complex Component 7 (MCM7))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MCM7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MCM7 antibody was raised against the middle region of MCM7
- Aufreinigung
- Purified
- Immunogen
- MCM7 antibody was raised using the middle region of MCM7 corresponding to a region with amino acids GGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV
- Top Product
- Discover our top product MCM7 Primärantikörper
-
anti-Minichromosome Maintenance Complex Component 7 (MCM7) (AA 1-389) antibody
MCM7 Reaktivität: Human WB, IF, IHC (p), ELISA, PLA Wirt: Maus Monoclonal 6C2 unconjugated
anti-Minichromosome Maintenance Complex Component 7 (MCM7) antibodyMCM7 Reaktivität: Human WB, IF, IHC (p), IP, ICC, ChIP Wirt: Kaninchen Polyclonal unconjugated
anti-Minichromosome Maintenance Complex Component 7 (MCM7) (AA 360-719) antibodyMCM7 Reaktivität: Human WB, IF, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Minichromosome Maintenance Complex Component 7 (MCM7) (AA 526-719) antibodyMCM7 Reaktivität: Human, Maus, Ratte WB, IHC (p), ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Minichromosome Maintenance Complex Component 7 (MCM7) (Internal Region) antibodyMCM7 Reaktivität: Human, Maus, Ratte WB, IHC (p), ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Minichromosome Maintenance Complex Component 7 (MCM7) (AA 195-319) antibodyMCM7 Reaktivität: Human WB, IHC, StM Wirt: Maus Monoclonal MCM7-1466 unconjugated
anti-Minichromosome Maintenance Complex Component 7 (MCM7) (AA 195-319) antibodyMCM7 Reaktivität: Human WB, IHC, StM Wirt: Kaninchen Monoclonal MCM7-2832R unconjugated Recombinant Antibody
anti-Minichromosome Maintenance Complex Component 7 (MCM7) (AA 195-319) antibodyMCM7 Reaktivität: Human IHC, IF, FACS, StM Wirt: Maus Monoclonal MCM7-1467 unconjugated
anti-Minichromosome Maintenance Complex Component 7 (MCM7) (AA 195-319) antibodyMCM7 Reaktivität: Human WB, IHC, StM Wirt: Maus Monoclonal rMCM7-1468 unconjugated Recombinant Antibody
anti-Minichromosome Maintenance Complex Component 7 (MCM7) (AA 1-719) antibodyMCM7 Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MCM7 Blocking Peptide, catalog no. 33R-3298, is also available for use as a blocking control in assays to test for specificity of this MCM7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MCM7 (Minichromosome Maintenance Complex Component 7 (MCM7))
- Andere Bezeichnung
- MCM7 (MCM7 Produkte)
- Hintergrund
- MCM7 encodes a protein that is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 6 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme.
- Molekulargewicht
- 42 kDa (MW of target protein)
- Pathways
- DNA Reparatur, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA
-
