MCM7 Antikörper (N-Term)

Produktnummer ABIN630182

Der Kaninchen Polyklonal Anti-MCM7-Antikörper wurde für WB validiert. Er ist geeignet, MCM7 in Proben von Human zu detektieren.

Kurzübersicht für MCM7 Antikörper (N-Term) (ABIN630182)

Target: MCM7 (Minichromosome Maintenance Complex Component 7 (MCM7))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MCM7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MCM7 Antikörper

Bindungsspezifität: N-Term

Spezifität: MCM7 antibody was raised against the N terminal of MCM7

Aufreinigung: Purified

Immunogen: MCM7 antibody was raised using the N terminal of MCM7 corresponding to a region with amino acids MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYV

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MCM7 Blocking Peptide, (ABIN5614704), is also available for use as a blocking control in assays to test for specificity of this MCM7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MCM7

Target: MCM7 (Minichromosome Maintenance Complex Component 7 (MCM7))

Andere Bezeichnung: MCM7

Hintergrund: MCM7 encodes a protein that is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 6 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. Cyclin D1-dependent kinase, CDK4, is found to associate with this protein, and may regulate the binding of this protein with the tumorsuppressor protein RB1/RB.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: DNA Reparatur, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA