FEN1 Antikörper (C-Term)

Produktnummer ABIN630178

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch FEN1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte und Hund.

Kurzübersicht für FEN1 Antikörper (C-Term) (ABIN630178)

Target: FEN1 (Flap Structure-Specific Endonuclease 1 (FEN1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FEN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FEN1 Antikörper

Bindungsspezifität: C-Term

Spezifität: FEN1 antibody was raised against the C terminal of FEN1

Aufreinigung: Purified

Immunogen: FEN1 antibody was raised using the C terminal of FEN1 corresponding to a region with amino acids PNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSL

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FEN1 Blocking Peptide, (ABIN5613568), is also available for use as a blocking control in assays to test for specificity of this FEN1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FEN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FEN1

Target: FEN1 (Flap Structure-Specific Endonuclease 1 (FEN1))

Andere Bezeichnung: FEN1

Hintergrund: FEN1 removes 5' overhanging flaps in DNA repair and processes the 5' ends of Okazaki fragments in lagging strand DNA synthesis. Direct physical interaction between this protein and AP endonuclease 1 during long-patch base excision repair provides coordinated loading of the proteins onto the substrate, thus passing the substrate from one enzyme to another. The protein is a member of the XPG/RAD2 endonuclease family and is one of ten proteins essential for cell-free DNA replication. DNA secondary structure can inhibit flap processing at certain trinucleotide repeats in a length-dependent manner by concealing the 5' end of the flap that is necessary for both binding and cleavage by the protein encoded by this gene. Therefore, secondary structure can deter the protective function of this protein, leading to site-specific trinucleotide expansions.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: Telomere Maintenance, DNA Reparatur, DNA Replication, Synthesis of DNA