PLAP Antikörper
-
- Target Alle PLAP (ALPP) Antikörper anzeigen
- PLAP (ALPP) (Placental Alkaline Phosphatase (ALPP))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PLAP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- ALPP antibody was raised using a synthetic peptide corresponding to a region with amino acids TVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVA
- Top Product
- Discover our top product ALPP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ALPP Blocking Peptide, catalog no. 33R-9362, is also available for use as a blocking control in assays to test for specificity of this ALPP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALPP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PLAP (ALPP) (Placental Alkaline Phosphatase (ALPP))
- Andere Bezeichnung
- ALPP (ALPP Produkte)
- Synonyme
- ECK0378 antikoerper, JW0374 antikoerper, psiA antikoerper, ALP antikoerper, PALP antikoerper, PLAP antikoerper, PLAP-1 antikoerper, ILC antikoerper, CTACK antikoerper, ESkine antikoerper, Akp2 antikoerper, alp antikoerper, zgc:56672 antikoerper, DDBDRAFT_0205491 antikoerper, DDBDRAFT_0231570 antikoerper, DDB_0205491 antikoerper, DDB_0231570 antikoerper, ALPI antikoerper, Actn2lp antikoerper, Alp antikoerper, bacterial alkaline phosphatase antikoerper, alkaline phosphatase, placental antikoerper, alkaline phosphatase, placental type antikoerper, C-C motif chemokine ligand 27 antikoerper, alkaline phosphatase, liver/bone/kidney antikoerper, alkaline phosphatase antikoerper, alkaline phosphatase, intestinal antikoerper, PDZ and LIM domain 3 antikoerper, phoA antikoerper, ALPP antikoerper, LOC100436725 antikoerper, CCL27 antikoerper, alpl antikoerper, alp antikoerper, ALPI antikoerper, Pdlim3 antikoerper, Alpp antikoerper
- Hintergrund
- There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2 while the tissue non-specific form is located on chromosome 1. ALPP is a membrane bound glycosylated enzyme, also referred to as the heat stable form, that is expressed primarily in the placenta although it is closely related to the intestinal form of the enzyme as well as to the placental-like form.
- Molekulargewicht
- 59 kDa (MW of target protein)
-