GABRG2 Antikörper

Produktnummer ABIN630118

Produktdetails anti-GABRG2 Antikörper

Target: GABRG2 (gamma-aminobutyric Acid (GABA) A Receptor, gamma 2 (GABRG2))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GABRG2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: GABRG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMDLFVSVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPAPTIDIR

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GABRG2 Blocking Peptide, catalog no. 33R-1384, is also available for use as a blocking control in assays to test for specificity of this GABRG2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRG2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GABRG2

Target: GABRG2 (gamma-aminobutyric Acid (GABA) A Receptor, gamma 2 (GABRG2))

Andere Bezeichnung: GABRG2 (GABRG2 Produkte)

Synonyme: cae2 antikoerper, eca2 antikoerper, gabrg1 antikoerper, gefsp3 antikoerper, si:ch211-145n14.1 antikoerper, CAE2 antikoerper, ECA2 antikoerper, GEFSP3 antikoerper, GABAA-R antikoerper, Gabrg-2 antikoerper, gamma2 antikoerper, gamma-aminobutyric acid type A receptor gamma2 subunit antikoerper, gamma-aminobutyric acid (GABA) A receptor, gamma 2 antikoerper, gamma-aminobutyric acid type A receptor gamma 2 subunit antikoerper, gamma-aminobutyric acid (GABA) A receptor, subunit gamma 2 antikoerper, GABRG2 antikoerper, gabrg2 antikoerper, Gabrg2 antikoerper

Hintergrund: Gamma-aminobutyric acid (GABA), the major inhibitory neurotransmitter in the brain, mediates neuronal inhibition by binding to GABA receptors. The type A GABA receptors are pentameric chloride channels assembled from among many genetic variants of GABA(A) subunits. GABRG2 is the gamma 2 subunit of GABA(A) receptor. Mutations in this gene have been associated with epilepsy and febrile seizures.

Molekulargewicht: 36 kDa (MW of target protein)