CATSPER2 Antikörper (N-Term)

Produktnummer ABIN630061

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch CATSPER2 in WB und IHC. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für CATSPER2 Antikörper (N-Term) (ABIN630061)

Target: CATSPER2 (Cation Channel, Sperm Associated 2 (CATSPER2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CATSPER2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-CATSPER2 Antikörper

Bindungsspezifität: N-Term

Spezifität: CATSPER2 antibody was raised against the N terminal of CATSPER2

Aufreinigung: Purified

Immunogen: CATSPER2 antibody was raised using the N terminal of CATSPER2 corresponding to a region with amino acids HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHA

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CATSPER2 Blocking Peptide, (ABIN939170), is also available for use as a blocking control in assays to test for specificity of this CATSPER2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CATSPER2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CATSPER2

Target: CATSPER2 (Cation Channel, Sperm Associated 2 (CATSPER2))

Andere Bezeichnung: CATSPER2

Hintergrund: Calcium ions play a primary role in the regulation of sperm motility. Anti-CATSPER2 belongs to a family of putative cation channels that are specific to spermatozoa and localize to the flagellum. The protein family features a single repeat with six membrane-spanning segments and a predicted calcium-selective pore region. A second, closely linked copy of this gene has been identified. Although multiple transcript variants encoding protein isoforms have been characterized, they seem to be only transcribed from this gene. Additional splice variants have been described but their full-length nature has not been determined.

Molekulargewicht: 46 kDa (MW of target protein)