CATSPER2 Antikörper (C-Term)

Produktnummer ABIN630073

Produktdetails anti-CATSPER2 Antikörper

Target: CATSPER2 (Cation Channel, Sperm Associated 2 (CATSPER2))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CATSPER2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CATSPER2 antibody was raised against the C terminal of CATSPER2

Aufreinigung: Purified

Immunogen: CATSPER2 antibody was raised using the C terminal of CATSPER2 corresponding to a region with amino acids LMEMDQDDRVWPRDSLFRYFELLEKLQYNLEERKKLQEFAVQALMNLEDK

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CATSPER2 Blocking Peptide, catalog no. 33R-5202, is also available for use as a blocking control in assays to test for specificity of this CATSPER2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CATSPER2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CATSPER2

Target: CATSPER2 (Cation Channel, Sperm Associated 2 (CATSPER2))

Andere Bezeichnung: CATSPER2 (CATSPER2 Produkte)

Synonyme: CATSPER2 antikoerper, cation channel, sperm associated 2 antikoerper, cation channel sperm associated 2 antikoerper, CATSPER2 antikoerper, Catsper2 antikoerper

Hintergrund: Calcium ions play a primary role in the regulation of sperm motility. This gene belongs to a family of putative cation channels that are specific to spermatozoa and localize to the flagellum. The protein family features a single repeat with six membrane-spanning segments and a predicted calcium-selective pore region. This gene is part of a tandem repeat on chromosome 15q14, the second copy of this gene is thought to be a pseudogene. Additional splice variants have been described but their full-length nature has not been determined.

Molekulargewicht: 58 kDa (MW of target protein)