SF3B4 Antikörper (N-Term)
-
- Target Alle SF3B4 Antikörper anzeigen
- SF3B4 (Splicing Factor 3b, Subunit 4, 49kDa (SF3B4))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SF3B4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- SF3 B4 antibody was raised against the N terminal of SF3 4
- Aufreinigung
- Purified
- Immunogen
- SF3 B4 antibody was raised using the N terminal of SF3 4 corresponding to a region with amino acids QDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVE
- Top Product
- Discover our top product SF3B4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SF3B4 Blocking Peptide, catalog no. 33R-7491, is also available for use as a blocking control in assays to test for specificity of this SF3B4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SF3B4 (Splicing Factor 3b, Subunit 4, 49kDa (SF3B4))
- Andere Bezeichnung
- SF3B4 (SF3B4 Produkte)
- Synonyme
- chunp6902 antikoerper, fb36a04 antikoerper, wu:fb36a04 antikoerper, 49kDa antikoerper, SF3b49 antikoerper, SF3b50 antikoerper, Sap49 antikoerper, spx antikoerper, AFD1 antikoerper, Hsh49 antikoerper, SAP49 antikoerper, Splicing factor 3B subunit 4 antikoerper, splicing factor 3b, subunit 4 antikoerper, splicing factor 3b subunit 4 S homeolog antikoerper, splicing factor 3b subunit 4 antikoerper, sap-49 antikoerper, sf3b4 antikoerper, Sf3b4 antikoerper, sf3b4.S antikoerper, SF3B4 antikoerper
- Hintergrund
- SF3B4 is one of four subunits of the splicing factor 3B. The protein cross-links to a region in the pre-mRNA immediately upstream of the branchpoint sequence in pre-mRNA in the prespliceosomal complex A. It also may be involved in the assembly of the B, C and E spliceosomal complexes. In addition to RNA-binding activity, this protein interacts directly and highly specifically with subunit 2 of the splicing factor 3B. This protein contains two N-terminal RNA-recognition motifs (RRMs), consistent with the observation that it binds directly to pre-mRNA.
- Molekulargewicht
- 47 kDa (MW of target protein)
-