SF3B4 Antikörper (N-Term)

Produktnummer ABIN629981

Der Kaninchen Polyklonal anti-SF3B4 Antikörper wird verwendet zum Nachweis von SF3B4 in Proben von Human, Maus, Ratte, Hund und Zebrafisch (Danio rerio). Er wurde validiert für WB und IHC.

Kurzübersicht für SF3B4 Antikörper (N-Term) (ABIN629981)

Target: SF3B4 (Splicing Factor 3b, Subunit 4, 49kDa (SF3B4))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SF3B4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-SF3B4 Antikörper

Bindungsspezifität: N-Term

Spezifität: SF3 B4 antibody was raised against the N terminal of SF3 4

Aufreinigung: Purified

Immunogen: SF3 B4 antibody was raised using the N terminal of SF3 4 corresponding to a region with amino acids QDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVE

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SF3B4 Blocking Peptide, (ABIN5616091), is also available for use as a blocking control in assays to test for specificity of this SF3B4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SF3B4

Target: SF3B4 (Splicing Factor 3b, Subunit 4, 49kDa (SF3B4))

Andere Bezeichnung: SF3B4

Hintergrund: SF3B4 is one of four subunits of the splicing factor 3B. The protein cross-links to a region in the pre-mRNA immediately upstream of the branchpoint sequence in pre-mRNA in the prespliceosomal complex A. It also may be involved in the assembly of the B, C and E spliceosomal complexes. In addition to RNA-binding activity, this protein interacts directly and highly specifically with subunit 2 of the splicing factor 3B. This protein contains two N-terminal RNA-recognition motifs (RRMs), consistent with the observation that it binds directly to pre-mRNA.

Molekulargewicht: 47 kDa (MW of target protein)