RELB Antikörper (C-Term)

Produktnummer ABIN629859

Produktdetails anti-RELB Antikörper

Target: RELB (V-Rel Reticuloendotheliosis Viral Oncogene Homolog B (RELB))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RELB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RELB antibody was raised against the C terminal of RELB

Aufreinigung: Purified

Immunogen: RELB antibody was raised using the C terminal of RELB corresponding to a region with amino acids GPEPLTLDSYQAPGPGDGGTASLVGSNMFPNHYREAAFGGGLLSPGPEAT

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RELB Blocking Peptide, catalog no. 33R-3469, is also available for use as a blocking control in assays to test for specificity of this RELB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RELB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RELB

Target: RELB (V-Rel Reticuloendotheliosis Viral Oncogene Homolog B (RELB))

Andere Bezeichnung: RELB (RELB Produkte)

Synonyme: shep antikoerper, I-REL antikoerper, IREL antikoerper, REL-B antikoerper, XRelB antikoerper, relb-A antikoerper, GC-rich antikoerper, avian reticuloendotheliosis viral (v-rel) oncogene related B antikoerper, RELB proto-oncogene, NF-kB subunit antikoerper, v-rel avian reticuloendotheliosis viral oncogene homolog B S homeolog antikoerper, Relb antikoerper, RELB antikoerper, relb.S antikoerper

Hintergrund: RELB neither associates with DNA nor with RELA/p65 or REL. It stimulates promoter activity in the presence of NFKB2/p49.

Molekulargewicht: 62 kDa (MW of target protein)

Pathways: NF-kappaB Signalweg, RTK Signalweg