ACTR2 Antikörper

Produktnummer ABIN629770

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch ACTR2 in WB und IHC. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte und Hund.

Kurzübersicht für ACTR2 Antikörper (ABIN629770)

Target: ACTR2 (Actin-Related Protein 2 (ACTR2))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACTR2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-ACTR2 Antikörper

Aufreinigung: Purified

Immunogen: ACTR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVE

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACTR2 Blocking Peptide, (ABIN5611924), is also available for use as a blocking control in assays to test for specificity of this ACTR2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACTR2

Target: ACTR2 (Actin-Related Protein 2 (ACTR2))

Andere Bezeichnung: ACTR2

Hintergrund: ACTR2 is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion.

Molekulargewicht: 45 kDa (MW of target protein)

Pathways: RTK Signalweg, Regulation of Actin Filament Polymerization