MAT1A Antikörper (N-Term)

Produktnummer ABIN629745

Dieses Anti-MAT1A-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von MAT1A in WB und IHC. Geeignet für Human, Maus, Ratte, Hund, Drosophila melanogaster und C. elegans.

Kurzübersicht für MAT1A Antikörper (N-Term) (ABIN629745)

Target: MAT1A (Methionine Adenosyltransferase I, alpha (MAT1A))

Reaktivität: Human, Maus, Ratte, Hund, Drosophila melanogaster, C. elegans

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAT1A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-MAT1A Antikörper

Bindungsspezifität: N-Term

Spezifität: MAT1 A antibody was raised against the N terminal of MAT1

Aufreinigung: Purified

Immunogen: MAT1 A antibody was raised using the N terminal of MAT1 corresponding to a region with amino acids TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAT1A Blocking Peptide, (ABIN5614678), is also available for use as a blocking control in assays to test for specificity of this MAT1A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAT0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAT1A

Target: MAT1A (Methionine Adenosyltransferase I, alpha (MAT1A))

Andere Bezeichnung: MAT1A

Hintergrund: MAT1A catalyzes the formation of S-adenosylmethionine from methionine and ATP. Methionine adenosyltransferase deficiency is caused by recessive and dominant mutations, the latter identified in autosomal dominant persistant hypermethioninemia.

Molekulargewicht: 43 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, M Phase, Ribonucleoside Biosynthetic Process, Methionine Biosynthetic Process