UBE2N Antikörper

Produktnummer ABIN629730

Der Kaninchen Polyklonal anti-UBE2N Antikörper (ABIN629730) detektiert spezifisch UBE2N in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Ratte, Maus, Zebrafisch (Danio rerio), Hund und Drosophila melanogaster.

Kurzübersicht für UBE2N Antikörper (ABIN629730)

Target: UBE2N (Ubiquitin-Conjugating Enzyme E2N (UBE2N))

Reaktivität: Human, Ratte, Maus, Zebrafisch (Danio rerio), Hund, Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBE2N Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-UBE2N Antikörper

Aufreinigung: Purified

Immunogen: UBE2 N antibody was raised using a synthetic peptide corresponding to a region with amino acids VDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQW

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UBE2N Blocking Peptide, (ABIN5616876), is also available for use as a blocking control in assays to test for specificity of this UBE2N antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBE2N

Target: UBE2N (Ubiquitin-Conjugating Enzyme E2N (UBE2N))

Andere Bezeichnung: UBE2N

Hintergrund: UBE2N encodes a member of the E2 ubiquitin-conjugating enzyme family. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. Studies in mouse suggest that this protein plays a role in DNA postreplication repair.

Molekulargewicht: 17 kDa (MW of target protein)

Pathways: T-Zell Rezeptor Signalweg, Fc-epsilon Rezeptor Signalübertragung, Activation of Innate immune Response, Toll-Like Receptors Cascades, Positive Regulation of Response to DNA Damage Stimulus, Ubiquitin Proteasome Pathway