UBE2N Antikörper

Produktnummer ABIN629720

Produktdetails anti-UBE2N Antikörper

Target: UBE2N (Ubiquitin-Conjugating Enzyme E2N (UBE2N))

Reaktivität: Human, Ratte, Maus, Zebrafisch (Danio rerio), Hund, Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBE2N Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: UBE2 N antibody was raised using a synthetic peptide corresponding to a region with amino acids GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNE

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UBE2N Blocking Peptide, catalog no. 33R-3532, is also available for use as a blocking control in assays to test for specificity of this UBE2N antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBE2N

Target: UBE2N (Ubiquitin-Conjugating Enzyme E2N (UBE2N))

Andere Bezeichnung: UBE2N (UBE2N Produkte)

Synonyme: UBC13 antikoerper, UbcH-ben antikoerper, UbcH13 antikoerper, 1500026J17Rik antikoerper, AL022654 antikoerper, BB101821 antikoerper, ube2n antikoerper, wu:fb11b03 antikoerper, wu:fc08b06 antikoerper, zgc:55726 antikoerper, ubc13 antikoerper, ubch-ben antikoerper, UBE2N antikoerper, ube2nl antikoerper, zgc:63901 antikoerper, ubiquitin conjugating enzyme E2 N antikoerper, ubiquitin-conjugating enzyme E2N antikoerper, ubiquitin conjugating enzyme E2 N S homeolog antikoerper, ubiquitin-conjugating enzyme E2Na antikoerper, ubiquitin-conjugating enzyme E2Nb antikoerper, UBE2N antikoerper, Ube2n antikoerper, ube2n.S antikoerper, ube2na antikoerper, LOC100533434 antikoerper, ube2n antikoerper, ube2nb antikoerper

Hintergrund: UBE2N encodes a member of the E2 ubiquitin-conjugating enzyme family. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. Studies in mouse suggest that this protein plays a role in DNA postreplication repair.

Molekulargewicht: 17 kDa (MW of target protein)

Pathways: T-Zell Rezeptor Signalweg, Fc-epsilon Rezeptor Signalübertragung, Activation of Innate immune Response, Toll-Like Receptors Cascades, Positive Regulation of Response to DNA Damage Stimulus, Ubiquitin Proteasome Pathway