LKB1 Antikörper (N-Term)

Produktnummer ABIN629708

Produktdetails anti-LKB1 Antikörper

Target: LKB1 (STK11) (serine/threonine Kinase 11 (STK11))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Zebrafisch (Danio rerio), Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LKB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: STK11 antibody was raised against the N terminal of STK11

Aufreinigung: Purified

Immunogen: STK11 antibody was raised using the N terminal of STK11 corresponding to a region with amino acids TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

STK11 Blocking Peptide, catalog no. 33R-9160, is also available for use as a blocking control in assays to test for specificity of this STK11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STK11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LKB1

Target: LKB1 (STK11) (serine/threonine Kinase 11 (STK11))

Andere Bezeichnung: STK11 (STK11 Produkte)

Synonyme: pjs antikoerper, LKB1 antikoerper, XEEK1 antikoerper, Stk11 antikoerper, PJS antikoerper, hLKB1 antikoerper, AA408040 antikoerper, Lkb1 antikoerper, Par-4 antikoerper, R75140 antikoerper, mLKB1 antikoerper, wu:fj61a05 antikoerper, zgc:110180 antikoerper, xeek1 antikoerper, serine/threonine kinase 11 antikoerper, polarization-related protein LKB1 antikoerper, serine/threonine kinase 11 L homeolog antikoerper, STK11 antikoerper, stk11 antikoerper, LOC662493 antikoerper, Stk11 antikoerper, stk11.L antikoerper

Hintergrund: STK11is a member of the serine/threonine kinase family, regulates cell polarity and functions as a tumor suppressor. Mutations in its gene have been associated with Peutz-Jeghers syndrome, an autosomal dominant disorder characterized by the growth of polyps in the gastrointestinal tract, pigmented macules on the skin and mouth, and other neoplasms.

Molekulargewicht: 48 kDa (MW of target protein)

Pathways: AMPK Signaling, Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, Warburg Effekt