LKB1 Antikörper (N-Term)

Produktnummer ABIN629708

Der Kaninchen Polyklonal Anti-LKB1-Antikörper wurde für WB und IHC validiert. Er ist geeignet, LKB1 in Proben von Human, Maus, Ratte, Zebrafisch (Danio rerio) und Hund zu detektieren.

Kurzübersicht für LKB1 Antikörper (N-Term) (ABIN629708)

Target: LKB1 (STK11) (serine/threonine Kinase 11 (STK11))

Reaktivität: Human, Maus, Ratte, Zebrafisch (Danio rerio), Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LKB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-LKB1 Antikörper

Bindungsspezifität: N-Term

Spezifität: STK11 antibody was raised against the N terminal of STK11

Aufreinigung: Purified

Immunogen: STK11 antibody was raised using the N terminal of STK11 corresponding to a region with amino acids TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

STK11 Blocking Peptide, (ABIN5616437), is also available for use as a blocking control in assays to test for specificity of this STK11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STK11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LKB1

Target: LKB1 (STK11) (serine/threonine Kinase 11 (STK11))

Andere Bezeichnung: STK11

Hintergrund: STK11is a member of the serine/threonine kinase family, regulates cell polarity and functions as a tumor suppressor. Mutations in its gene have been associated with Peutz-Jeghers syndrome, an autosomal dominant disorder characterized by the growth of polyps in the gastrointestinal tract, pigmented macules on the skin and mouth, and other neoplasms.

Molekulargewicht: 48 kDa (MW of target protein)

Pathways: AMPK Signaling, Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, Warburg Effekt