PDHA1 Antikörper

Produktnummer ABIN629667

Der Kaninchen Polyklonal anti-PDHA1 Antikörper (ABIN629667) detektiert spezifisch PDHA1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für PDHA1 Antikörper (ABIN629667)

Target: PDHA1 (Pyruvate Dehydrogenase (Lipoamide) alpha 1 (PDHA1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDHA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PDHA1 Antikörper

Aufreinigung: Purified

Immunogen: PDHA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRKMLAAVSRVLSGASQKPASRVLVASRNFANDATFEIKKCDLHRLEEGP

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PDHA1 Blocking Peptide, (ABIN5615283), is also available for use as a blocking control in assays to test for specificity of this PDHA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDHA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDHA1

Target: PDHA1 (Pyruvate Dehydrogenase (Lipoamide) alpha 1 (PDHA1))

Andere Bezeichnung: PDHA1

Hintergrund: The pyruvate dehydrogenase complex is a nuclear-encoded mitochondrial matrix multienzyme complex that provides the primary link between glycolysis and the tricarboxylic acid (TCA) cycle by catalyzing the irreversible conversion of pyruvate into acetyl-CoA. The PDH complex is composed of multiple copies of 3 enzymes: E1 (PDHA1), dihydrolipoyl transacetylase (DLAT), and dihydrolipoyl dehydrogenase (DLD).

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: Warburg Effekt