PRP19 Antikörper

Produktnummer ABIN629622

Dieses Anti-PRP19-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von PRP19 in WB und IHC. Geeignet für Human, Maus, Ratte, Hund und Zebrafisch (Danio rerio).

Kurzübersicht für PRP19 Antikörper (ABIN629622)

Target: PRP19 (PRPF19) (Pre-mRNA Processing Factor 19 (PRPF19))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRP19 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-PRP19 Antikörper

Aufreinigung: Purified

Immunogen: PRPF19 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVK

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRPF19 Blocking Peptide, (ABIN5615578), is also available for use as a blocking control in assays to test for specificity of this PRPF19 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPF19 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRP19

Target: PRP19 (PRPF19) (Pre-mRNA Processing Factor 19 (PRPF19))

Andere Bezeichnung: PRPF19

Hintergrund: PRPF19 plays a role in DNA double-strand break (DSB) repair and pre-mRNA splicing reaction. It binds double-stranded DNA in a sequence-nonspecific manner. PRPF19 acts as a structural component of the nuclear framework. It may also serve as a support for spliceosome binding and activity. It is essential for spliceosome assembly in a oligomerization-dependent manner and might also be important for spliceosome stability. It also may have E3 ubiquitin ligase activity.

Molekulargewicht: 55 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization