RAD23A Antikörper
-
- Target Alle RAD23A Antikörper anzeigen
- RAD23A (RAD23 Homolog A (RAD23A))
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RAD23A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- RAD23 A antibody was raised using a synthetic peptide corresponding to a region with amino acids GIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQ
- Top Product
- Discover our top product RAD23A Primärantikörper
-
anti-RAD23 Homolog A (RAD23A) (AA 1-363) antibody
RAD23A Reaktivität: Human WB, ELISA, IHC, ICC, FACS Wirt: Maus Monoclonal 3E3F4 unconjugated
anti-RAD23 Homolog A (RAD23A) (AA 151-250) antibodyRAD23A Reaktivität: Human WB, ELISA, RNAi Wirt: Maus Monoclonal 3C12 unconjugated
anti-RAD23 Homolog A (RAD23A) antibodyRAD23A Reaktivität: Human WB, IF Wirt: Kaninchen Monoclonal unconjugated
anti-RAD23 Homolog A (RAD23A) (AA 2-201) antibodyRAD23A Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-RAD23 Homolog A (RAD23A) (AA 303-333), (C-Term) antibodyRAD23A Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB4541-4542 unconjugated
anti-RAD23 Homolog A (RAD23A) (AA 122-135) antibodyRAD23A Reaktivität: Human WB, ELISA Wirt: Ziege Polyclonal unconjugated
anti-RAD23 Homolog A (RAD23A) (C-Term) antibodyRAD23A Reaktivität: Human, Maus, Ratte WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-RAD23 Homolog A (RAD23A) (AA 201-250) antibodyRAD23A Reaktivität: Human, Maus, Ratte, Hund, Kaninchen, Pferd, Rind (Kuh), Schwein, Affe, Fledermaus WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-RAD23 Homolog A (RAD23A) (AA 141-190) antibodyRAD23A Reaktivität: Human, Maus, Ratte, Hund, Kaninchen, Pferd, Meerschweinchen, Schwein, Affe, Fledermaus WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-RAD23 Homolog A (RAD23A) (Center) antibodyRAD23A Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RAD23A Blocking Peptide, catalog no. 33R-3339, is also available for use as a blocking control in assays to test for specificity of this RAD23A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD20 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAD23A (RAD23 Homolog A (RAD23A))
- Andere Bezeichnung
- RAD23A (RAD23A Produkte)
- Synonyme
- rad23a antikoerper, wu:fe11h06 antikoerper, zgc:92001 antikoerper, RAD23A antikoerper, HHR23A antikoerper, HR23A antikoerper, 2310040P19Rik antikoerper, AL024030 antikoerper, mHR23A antikoerper, RAD23 homolog A, nucleotide excision repair protein a antikoerper, RAD23 homolog A, nucleotide excision repair protein antikoerper, rad23aa antikoerper, RAD23A antikoerper, Rad23a antikoerper
- Hintergrund
- RAD23A is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in nucleotide excision repair (NER). This protein was shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair.
- Molekulargewicht
- 40 kDa (MW of target protein)
- Pathways
- DNA Reparatur
-
