RAD23A Antikörper

Produktnummer ABIN629610

Dieser Anti-RAD23A-Antikörper ist ein Kaninchen-Polyklonal-Antikörper zum Nachweis von RAD23A in WB und IHC. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für RAD23A Antikörper (ABIN629610)

Target: RAD23A (RAD23 Homolog A (RAD23A))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAD23A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-RAD23A Antikörper

Aufreinigung: Purified

Immunogen: RAD23 A antibody was raised using a synthetic peptide corresponding to a region with amino acids GIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQ

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAD23A Blocking Peptide, (ABIN938725), is also available for use as a blocking control in assays to test for specificity of this RAD23A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD20 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAD23A

Target: RAD23A (RAD23 Homolog A (RAD23A))

Andere Bezeichnung: RAD23A

Hintergrund: RAD23A is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in nucleotide excision repair (NER). This protein was shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: DNA Reparatur