ASXL1 Antikörper
-
- Target Alle ASXL1 Antikörper anzeigen
- ASXL1 (Additional Sex Combs Like 1 (ASXL1))
- Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ASXL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Marke
- Picoband™
- Sequenz
- KKERTWAEAA RLVLENYSDA PMTPKQILQV IEAE
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
- Rabbit IgG polyclonal antibody for ASXL1 detection. Tested with WB in Human,Mouse,Rat.
- Immunogen
- A synthetic peptide corresponding to a sequence of human ASXL1 (KKERTWAEAARLVLENYSDAPMTPKQILQVIEAE).
- Top Product
- Discover our top product ASXL1 Primärantikörper
-
-
- Applikationshinweise
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
Application Details: Western blot, 0.1-0.5 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- ASXL1 (Additional Sex Combs Like 1 (ASXL1))
- Andere Bezeichnung
- ASXL1 (ASXL1 Produkte)
- Synonyme
- asxl1 antikoerper, MGC83850 antikoerper, mKIAA0978 antikoerper, BOPS antikoerper, MDS antikoerper, additional sex combs like 1, transcriptional regulator L homeolog antikoerper, additional sex combs like 1, transcriptional regulator antikoerper, additional sex combs like 1 antikoerper, asxl1.L antikoerper, ASXL1 antikoerper, asxl1 antikoerper, Asxl1 antikoerper
- Hintergrund
-
Synonyms: Putative Polycomb group protein ASXL1, Additional sex combs-like protein 1, ASXL1, KIAA0978
Tissue Specificity: Widely expressed at low level. Expressed in heart, brain, skeletal muscle, placenta, pancreas, spleen, prostate, small intestine, colon, peripheral blood, leukocytes, bone marrow and fetal liver. Highly expressed in testes.
Background: Putative Polycomb group protein ASXL1 is a protein that in humans is encoded by the ASXL1 gene. This gene is similar to the Drosophila additional sex combs gene, which encodes a chromatin-binding protein required for normal determination of segment identity in the developing embryo. The protein is a member of the Polycomb group of proteins, which are necessary for the maintenance of stable repression of homeotic and other loci. The protein is thought to disrupt chromatin in localized areas, enhancing transcription of certain genes while repressing the transcription of other genes. The protein encoded by this gene functions as a ligand-dependent co-activator for retinoic acid receptor in cooperation with nuclear receptor coactivator 1. Mutations in this gene are associated with myelodysplastic syndromes and chronic myelomonocytic leukemia. Alternative splicing results in multiple transcript variants.
- Pathways
- Retinoic Acid Receptor Signaling Pathway
-