Retinoblastoma Binding Protein 4 Antikörper (C-Term)

Produktnummer ABIN5692929

Produktdetails anti-Retinoblastoma Binding Protein 4 Antikörper

Target: Retinoblastoma Binding Protein 4 (RBBP4)

Bindungsspezifität: AA 395-425, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser Retinoblastoma Binding Protein 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Marke: Picoband™

Sequenz: EDNIMQVWQM AENIYNDEDP EGSVDPEGQG S

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Mouse IgG monoclonal antibody for RbAp48 detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human RbAp48 (395-425aa EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS), identical to the related mouse sequence.

Klon: 9F3

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Informationen zur Lagerung: At -20℃, for one year. After reconstitution, at 4℃, for one month.
It can also be aliquotted and stored frozen at -20℃, for a longer time. Avoid repeated freezing and thawing.

Details zu Retinoblastoma Binding Protein 4

Target: Retinoblastoma Binding Protein 4 (RBBP4)

Andere Bezeichnung: RBBP4 (RBBP4 Produkte)

Synonyme: NURF55 antikoerper, RBAP48 antikoerper, 154659_at antikoerper, 55 antikoerper, CAF-1 antikoerper, CAF1 antikoerper, CAF1-55 antikoerper, CAF1p55 antikoerper, CG4236 antikoerper, Caf-1 antikoerper, Caf1/p55 antikoerper, Caf1p55 antikoerper, Dmel\\CG4236 antikoerper, MSI1/RbAp48/CAC3/LIN-53 antikoerper, NURF antikoerper, NURF-55 antikoerper, Nurf antikoerper, Nurf 55 antikoerper, Nurf-55 antikoerper, Nurf55 antikoerper, P55 antikoerper, RbAp48 antikoerper, S(ls)3 antikoerper, caf-1 antikoerper, caf1 antikoerper, caf1 p55 antikoerper, d-CAF1 antikoerper, dCAF-1 antikoerper, dCAF-1 p55 antikoerper, dNURF antikoerper, p55 antikoerper, p55 CAF1 antikoerper, p55/NURF-55 antikoerper, p55CAF1 antikoerper, nurf55 antikoerper, rbap48 antikoerper, xrbbp4 antikoerper, mRbAp48 antikoerper, RBBP4 antikoerper, rbb4-2 antikoerper, zgc:55349 antikoerper, zgc:77854 antikoerper, wu:fb33a09 antikoerper, wu:fb40e10 antikoerper, RBBP-4 antikoerper, rbbp4 antikoerper, M4E13.110 antikoerper, M4E13_110 antikoerper, MULTICOPY SUPPRESSOR OF IRA1 3 antikoerper, NFC3 antikoerper, NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP C 3 antikoerper, RB binding protein 4, chromatin remodeling factor antikoerper, Chromatin assembly factor 1, p55 subunit antikoerper, retinoblastoma binding protein 4 antikoerper, retinoblastoma binding protein 4, chromatin remodeling factor antikoerper, retinoblastoma binding protein 4 L homeolog antikoerper, Transducin family protein / WD-40 repeat family protein antikoerper, retinoblastoma binding protein 4 S homeolog antikoerper, RBBP4 antikoerper, Caf1-55 antikoerper, rbbp4 antikoerper, Rbbp4 antikoerper, rbbp4.L antikoerper, MSI3 antikoerper, rbbp4.S antikoerper

Hintergrund:

Synonyms: Histone-binding protein RBBP4, Chromatin assembly factor 1 subunit C, CAF-1 subunit C, Chromatin assembly factor I p48 subunit, CAF-I 48 kDa subunit, CAF-I p48, Nucleosome-remodeling factor subunit RBAP48, Retinoblastoma-binding protein 4, RBBP-4, Retinoblastoma-binding protein p48, RBBP4, RBAP48

Background: Histone-binding protein RBBP4 (also known as RbAp48, or NURF55) is a protein that in humans is encoded by the RBBP4 gene. This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. And it is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of co-repressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. This protein also seems to be involved in transcriptional repression of E2F-responsive genes. Three transcript variants encoding different isoforms have been found for this gene.

UniProt: Q09028

Pathways: Zellzyklus, Mitotic G1-G1/S Phases, Stem Cell Maintenance, Chromatin Binding, Protein targeting to Nucleus