PDGFB Antikörper (AA 89-129)

Produktnummer ABIN5647896

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch PDGFB in WB. Es zeigt Reaktivität gegenüber Proben von Ratte und Maus.

Kurzübersicht für PDGFB Antikörper (AA 89-129) (ABIN5647896)

Target: PDGFB (Platelet Derived Growth Factor Subunit B (PDGFB))

Reaktivität: Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDGFB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PDGFB Antikörper

Bindungsspezifität: AA 89-129

Verwendungszweck: PDGF beta Antibody

Sequenz: AEPAMIAECK TRTEVFEISR RLIDRTNANF LVWPPCVEVQ R

Kreuzreaktivität (Details): Expected species reactivity: Human

Aufreinigung: Antigen affinity

Immunogen: Amino acids 89-129 (AEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQR) from the human protein were used as the immunogen for the PDGF beta antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the PDGF beta antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the PDGF beta antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu PDGFB

Target: PDGFB (Platelet Derived Growth Factor Subunit B (PDGFB))

Andere Bezeichnung: PDGF beta

Hintergrund: Platelet-derived growth factor subunit B is a protein that in humans is encoded by the PDGFB gene. The protein encoded by this gene is a member of the platelet-derived growth factor family. This gene product can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. This gene is mapped to 22q13.1. Growth factor plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. This gene plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA.

UniProt: P01127

Pathways: RTK Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Regulation of Carbohydrate Metabolic Process, Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling