PDGFB Antikörper (N-Term)
-
- Target Alle PDGFB Antikörper anzeigen
- PDGFB (Platelet Derived Growth Factor Subunit B (PDGFB))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PDGFB Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PDGFB antibody was raised against the N terminal of PDGFB
- Aufreinigung
- Affinity purified
- Immunogen
- PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD
- Top Product
- Discover our top product PDGFB Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PDGFB Blocking Peptide, catalog no. 33R-6853, is also available for use as a blocking control in assays to test for specificity of this PDGFB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDGFB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PDGFB (Platelet Derived Growth Factor Subunit B (PDGFB))
- Andere Bezeichnung
- PDGFB (PDGFB Produkte)
- Synonyme
- PDGF-2 antikoerper, PDGF2 antikoerper, SIS antikoerper, SSV antikoerper, c-sis antikoerper, pdgf2 antikoerper, sis antikoerper, si:ch211-79m20.1 antikoerper, si:dkey-261d11.1 antikoerper, PDGF-B antikoerper, Sis antikoerper, platelet derived growth factor subunit B antikoerper, platelet-derived growth factor beta polypeptide antikoerper, platelet derived growth factor subunit B S homeolog antikoerper, platelet-derived growth factor beta polypeptide a antikoerper, platelet derived growth factor, B polypeptide antikoerper, PDGFB antikoerper, pdgfb.S antikoerper, pdgfba antikoerper, Pdgfb antikoerper
- Hintergrund
- PDGFB is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. PDGFB can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 7, at sites where this gene and that for COL1A1 are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans resulting from unregulated expression of growth factor.
- Molekulargewicht
- 27 kDa (MW of target protein)
- Pathways
- RTK Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Regulation of Carbohydrate Metabolic Process, Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling
-